Name :
Il3 (Mouse) Recombinant Protein
Biological Activity :
Mouse Il3 (P01586, 33 a.a. – 166 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P01586
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=16187
Amino Acid Sequence :
DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
Molecular Weight :
15
Storage and Stability :
Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Ion exchange column and HPLC reverse phase column
Quality Control Testing :
Storage Buffer :
Lyophilized from PBS
Applications :
Functional Study, SDS-PAGE,
Gene Name :
Il3
Gene Alias :
BPA, Csfmu, HCGF, Il-3, MCGF, PSF
Gene Description :
interleukin 3
Gene Summary :
Other Designations :
OTTMUSP00000005831
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CNTF Proteinweb
HGF web
Popular categories:
Retinoid X Receptor gamma
Deubiquitinase
