Share this post on:

Name :
Il3 (Mouse) Recombinant Protein

Biological Activity :
Mouse Il3 (P01586, 33 a.a. – 166 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
P01586

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=16187

Amino Acid Sequence :
DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Weight :
15

Storage and Stability :
Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
Ion exchange column and HPLC reverse phase column

Quality Control Testing :

Storage Buffer :
Lyophilized from PBS

Applications :
Functional Study, SDS-PAGE,

Gene Name :
Il3

Gene Alias :
BPA, Csfmu, HCGF, Il-3, MCGF, PSF

Gene Description :
interleukin 3

Gene Summary :

Other Designations :
OTTMUSP00000005831

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CNTF Proteinweb
HGF web
Popular categories:
Retinoid X Receptor gamma
Deubiquitinase

Share this post on:

Author: PDGFR inhibitor