Name :
FGF2 (Human) Recombinant Protein
Biological Activity :
Human FGF2 (P09038) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P09038
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2247
Amino Acid Sequence :
AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular Weight :
17.2
Storage and Stability :
Lyophilized although stable at room temperature for 3 weeks, should be stored desiccated below -20°C. Upon reconstitution should be stored at 4°C between 2-7 days and for future use below -20°C.Aliquot to avoid repeated freezing and thawing._x005f_x005f_x005f_x005f_x000D__x005f
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from 20mM Tris-HCl, pH7.4 and 1M NaCl
Applications :
Functional Study， SDS-PAGE，
Gene Name :
FGF2
Gene Alias :
BFGF, FGFB, HBGF-2
Gene Description :
fibroblast growth factor 2 (basic)
Gene Summary :
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq
Other Designations :
basic fibroblast growth factor bFGF|fibroblast growth factor 2|heparin-binding growth factor 2|prostatropin
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Insulin medchemexpress
BTN1A1 Proteincustom synthesis
Popular categories:
SARS-CoV-2 S1 Protein
IL-18
